fuskator.com

🖥 Status: up
🕒 Response Time: 0.001 sec
⬅️ Response Code: not set
fuskator.com

Over the last 2 102 days beginning November 11, 2020, to now, fuskator.com's accessibility was checked 155 times. Responding with a code 200, fuskator.com was operational 124 times, most recently on August 10, 2026, out of every check attempted. Out of all evaluations, fuskator.com was unreachable 2.58% of the time, equaling 4 events, with the latest occurrence on December 5, 2020. Among the 27 error-containing responses, the most current error, coded as 521, was detected on April 13, 2026. The August 10, 2026, response time of 0.001 seconds for fuskator.com differed from its average of 0.557 seconds.

4.0
155
Last Updated: August 10, 2026

Fuskator overview

Domain
fuskator.com
Title
Fuskator - Just Porn Galleries, That's All
Description
Fuskator provides nude image galleries contributed by users similar to image dump sites.
T Site Status Rank
4 456
Search Wikipedia
fuskator.com
Alternatives
alternatives to fuskator.com
Recently checked
r2games.com

educationcity.com

Last Updated: May 11, 2026
Status: up
Response Time: 0.001 sec
Response Code: not set

asianporndistrict.us

Last Updated: April 12, 2026
Status: down
Response Time: — sec
Response Code:

latexcatfish.com

Last Updated: July 25, 2026
Status: up
Response Time: 0.906 sec
Response Code: 200

sanesolution.com

Last Updated: July 5, 2026
Status: error
Response Time: 0.036 sec
Response Code: 403

portalcofen.gov.br

Last Updated: June 30, 2026
Status: up
Response Time: 1.415 sec
Response Code: 200

banneroftruth.org

Last Updated: June 10, 2026
Status: up
Response Time: 1.172 sec
Response Code: 200

atw.typepad.com

Last Updated: June 30, 2026
Status: error
Response Time: 0.066 sec
Response Code: 403

Fuskator.com
status check request map as of August 15, 2026

fuskator.com request, August 10, 2026

Country report for fuskator.com as of August 15, 2026

Other Countries 100.00%
14:07
SiteTotal ChecksLast Modified
verycd.comverycd.com44January 28, 2021
r2games.comr2games.com43January 28, 2021
fuskator.comfuskator.com155November 11, 2020
questionablecontent.netquestionablecontent.net51January 28, 2021
thumbtack.comthumbtack.com33January 28, 2021

Portalcofen.gov.br

Fuskator.com

General SEO Report

Page TitlePage Title tips for fuskator.com: For dynamic content websites using content management systems, automatic or semi-automatic title generators have become popular, yet human oversight remains crucial to ensure each generated title genuinely adheres to SEO best practices for that specific page and accurately reflects its content and purpose.
Fuskator - Just Porn Galleries, That's All

Length: 47 characters
Meta DescriptionMeta Description tips for fuskator.com: Sometimes, including power words related to your niche within the meta description copy can enhance conversion; just ensure natural flow and subordinate keyword placement doesn't suffer.
Fuskator provides nude image galleries contributed by users similar to image dump sites.

Length: 88 characters
Meta KeywordsMeta Keywords tips for fuskator.com: Modern search engine ranking algorithms are built on complex machine learning models analyzing hundreds of signals, far exceeding simple keyword matching from a meta tag, thus rendering keyword meta tags completely obsolete for any SEO strategy.
no meta keywords data for fuskator.com
2026-08-15T02:23:16+00:00
Page ContentPage Content tips for fuskator.com: Maximize search visibility by ensuring page content is well-structured with headings, bullet points, and concise paragraphs, facilitating readability, user satisfaction, and higher search rankings.
Web Page Content Length: 30355 characters
H1 HeadingH1 Heading tips for fuskator.com: The H1 header's prominence on the page directly impacts user dwell time and click-through rates; ensure it's clear, compelling, and mirrors the core content promise.
no h1 heading data for fuskator.com
2026-08-15T02:23:16+00:00
H2 HeadingsH2 Headings tips for fuskator.com: Consider the keyword focus of each section when crafting your H2 headers, ensuring they align with the main topic and target audience's search interests within the broader scope of your webpage.
no h2 headings data for fuskator.com
2026-08-15T02:23:16+00:00
H3 HeadingsH3 Headings tips for fuskator.com: Place H3 headers strategically throughout your copy to improve skimmability, allowing readers to grasp main points quickly and encouraging deeper exploration of your content.
no h3 headings data for fuskator.com
2026-08-15T02:23:16+00:00
H4 HeadingsH4 Headings tips for fuskator.com: Integrate H4 tags into FAQ schema structured data on your pages to provide rich snippets and answer user queries directly in search results, improving click-through rates.
no h4 headings data for fuskator.com
2026-08-15T02:23:16+00:00
H5-H6 HeadingsH5-H6 Headings tips for fuskator.com: Integrate H5-H6 headers strategically within content sections to enhance document semantics and user orientation on page layouts, ensuring content structure is clear for crawlers and readers, particularly in complex or supplementary sections.
no h5-h6 headings data for fuskator.com
2026-08-15T02:23:16+00:00
Image ALT AttributesImage ALT Attributes tips for fuskator.com: Replacing missing image source code with an alt attribute containing a meaningful description is essential for maintaining a good user experience across all devices and browsers, ensuring that even when images fail to load due to connection issues, the purpose is clear.
no image alt attributes data for fuskator.com
2026-08-15T02:23:16+00:00
Robots.txtRobots.txt tips for fuskator.com: The robots.txt file should reflect current security best practices, ensuring that restricted areas don't contain outdated or prediction-reliant user content potentially harming user trust and SEO performance metrics.
file robots.txt was found on the website
XML SitemapXML Sitemap tips for fuskator.com: Duplex XML sitemaps can provide timely promotion for newly published content, efficiently guiding crawlers to fresh pages faster, which is vital for maintaining and improving search rankings.
https://fuskator.com/sitemap_gallery.xml
https://fuskator.com/sitemap_gallery2.xml
https://fuskator.com/sitemap_gallery3.xml
https://fuskator.com/sitemap_gallery4.xml
https://fuskator.com/sitemap_gallery5.xml
https://fuskator.com/sitemap_gallery6.xml
https://fuskator.com/sitemap_gallery7.xml
https://fuskator.com/sitemap_gallery8.xml


available for crawling
Page SizePage Size tips for fuskator.com: Google's Page Speed Insights and other tools recommend smaller page sizes; analyze your website's assets, optimize images, and clean up code to achieve a page load size significantly under 1MB for improved SEO metrics.
page size: 30 kb
Response TimeResponse Time tips for fuskator.com: Thoroughly test website response times using both synthetic and real-user monitoring tools to accurately gauge performance; focusing optimization efforts on the areas causing slowest resource fetches post-HTML serves from the backend server provides tangible speed improvements.
response time: 0.557 sec
Minify CSSMinify CSS tips for fuskator.com: Overlooking the opportunity to minify CSS can significantly disadvantage competitive positions in organic search rankings where user experience signals increasingly influence algorithmic favorability, slowing engagement with core page content compared to rivals.
Minified:
/css/vendor.min.css?1.3.43
/css/fuskator.min.css?1.3.43


included in the page
Minify JavaScriptMinify JavaScript tips for fuskator.com: Quickly elevate your website's performance profile by diligently minifying every JavaScript file; systematically remove redundant white space characters, including tabs and line breaks traditionally used for human readability, and consider safe variable name shrinking to lower code complexity for browsers, resulting in vastly smaller file sizes and improved site speed monitoring tools which influence SEO metrics.
Minified:
/scripts/vendor.min.js?1.3.43
/scripts/global.min.js?1.3.43
/scripts/app.min.js?1.3.43
/ea.js


detected during site scan
Structured DataStructured Data tips for fuskator.com: Correctly tag your products, recipes, or business entities using Schema.org microdata (including JSON-LD) ensures search engines populate them correctly, not just indexing basic text but recognizing specific, actionable information relevant for user intent.
no structured data data for fuskator.com
2026-08-15T02:23:16+00:00
CDN UsageCDN Usage tips for fuskator.com: Analyze your website's Critical Rendering Path and prioritize caching the largest, most performance-sensitive render-blocking resources using a CDN, directly improving Time To First Meaningful Paint for your users.
no cdn usage data for fuskator.com
2026-08-15T02:23:16+00:00
SSL certificatesSSL certificates tips for fuskator.com: For WordPress sites and other content management systems, activating SSL via your hosting control panel or plugin settings is a straightforward method to achieve secure HTTPS and enhance SEO performance.
SSL is enabled on the website

Estimated Traffic

Minimum Daily Unique Visitors:371 657
Minimum Daily Visits:434 347
Minimum Daily Page Views:747 793
Minimum Monthly Unique Visitors:11 149 710
Minimum Monthly Visits:13 030 410
Minimum Monthly Page Views:22 433 790
Minimum Yearly Unique Visitors:133 796 520
Minimum Yearly Visits:156 364 920
Minimum Yearly Page Views:269 205 480
Maximum Daily Unique Visitors:470 169
Maximum Daily Visits:501 514
Maximum Daily Page Views:846 304
Maximum Monthly Unique Visitors:14 105 070
Maximum Monthly Visits:15 045 420
Maximum Monthly Page Views:25 389 120
Maximum Yearly Unique Visitors:169 260 840
Maximum Yearly Visits:180 545 040
Maximum Yearly Page Views:304 669 440

Estimated Valuation

Daily Revenue:US$ 537 - 1 209
Monthly Revenue:US$ 16 110 - 36 270
Yearly Revenue:US$ 193 320 - 435 240

Estimated Worth

Minimum:US$ 289 980
Maximum:US$ 1 305 720

Similarly Ranked Sites

RankPoints
plaync.complaync.com5 40011 560 001
nchsoftware.comnchsoftware.com5 40111 560 000
desjardins.comdesjardins.com5 40211 559 999
verycd.comverycd.com5 40311 559 998
r2games.comr2games.com5 40411 559 998
fuskator.comfuskator.com5 40511 559 997
questionablecontent.netquestionablecontent.net5 40611 559 996
thumbtack.comthumbtack.com5 40711 559 995
watchmygirlfriend.tvwatchmygirlfriend.tv5 40811 559 994
lever.colever.co5 40911 559 993
game-game.com.uagame-game.com.ua5 41011 559 993